CacheBy
Atlas Antibodies Anti-CPNE4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPNE4 Antibody

상품 한눈에 보기

Human CPNE4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 확인함. Affinity purification 방식으로 정제되었으며, 다양한 조직에서 RNA-seq 데이터와 비교 검증됨. Human, Mouse, Rat에 반응.

카탈로그번호
HPA078300-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA078300-100 Anti-CPNE4 Antibody, copine 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA078300-25 Anti-CPNE4 Antibody, copine 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPNE4 Antibody

Anti-CPNE4 Antibody

Target Protein: copine 4
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human CPNE4.

Alternative Gene Names

COPN4, CPN4

Open Datasheet

Target Information

항목 내용
Target Protein copine 4
Target Gene CPNE4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000032564 (97%)
Rat ENSRNOG00000026577 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.