CacheBy
Atlas Antibodies Anti-COL1A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL1A1 Antibody

상품 한눈에 보기

Human COL1A1 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 Affinity 정제됨. 인간에 대해 검증되었으며 Rat 및 Mouse와 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011795-100 Anti-COL1A1 Antibody, collagen, type I, alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011795-25 Anti-COL1A1 Antibody, collagen, type I, alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL1A1 Antibody

Anti-COL1A1 Antibody

Target: collagen, type I, alpha 1 (COL1A1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human COL1A1.


Alternative Gene Names

  • OI4

Open Datasheet


Target Information

항목 내용
Target Protein collagen, type I, alpha 1
Target Gene COL1A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000003897 (91%), Mouse ENSMUSG00000001506 (90%)

Antigen Sequence:

NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.