CacheBy
Atlas Antibodies Anti-COL1A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL1A1 Antibody

상품 한눈에 보기

인간 COL1A1 단백질을 표적으로 하는 폴리클로날 항체. 토끼에서 유래된 IgG 형태로 IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 보장. Human에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012111-100 Anti-COL1A1 Antibody, collagen type I alpha 1 chain 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012111-25 Anti-COL1A1 Antibody, collagen type I alpha 1 chain 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL1A1 Antibody

Anti-COL1A1 Antibody

Target Protein: collagen, type I, alpha 1
Alternative Gene Names: OI4

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human COL1A1.

Open Datasheet (PDF)

Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000003897): 91%
  • Mouse (ENSMUSG00000001506): 90%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.