CacheBy
Atlas Antibodies Anti-COL1A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL1A1 Antibody

상품 한눈에 보기

인체 COL1A1 단백질을 인식하는 폴리클로날 항체로 면역조직화학(IHC) 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, 고순도 친화정제 방식으로 제조되었습니다. 인체에 높은 반응성을 가지며 안정적인 PBS-글리세롤 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008405-100 Anti-COL1A1 Antibody, collagen, type I, alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008405-25 Anti-COL1A1 Antibody, collagen, type I, alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL1A1 Antibody

Anti-COL1A1 Antibody

Target: collagen, type I, alpha 1
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human COL1A1


Alternative Gene Names

OI4

Open Datasheet


Target Information

  • Target Protein: collagen, type I, alpha 1
  • Target Gene: COL1A1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000003897 91%
Mouse ENSMUSG00000001506 90%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.