CacheBy
Atlas Antibodies Anti-COL12A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL12A1 Antibody

상품 한눈에 보기

인체 COL12A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 가집니다. 40% 글리세롤/PBS 완충액에 보존제로 나트륨 아지드가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009143-100 Anti-COL12A1 Antibody, collagen, type XII, alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009143-25 Anti-COL12A1 Antibody, collagen, type XII, alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL12A1 Antibody

Anti-COL12A1 Antibody

Target: collagen, type XII, alpha 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human COL12A1.


Alternative Gene Names

  • COL12A1L

Open Datasheet


Target Information

항목 내용
Target Protein collagen, type XII, alpha 1
Target Gene COL12A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000058470 (86%), Mouse ENSMUSG00000032332 (86%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Material Safety Data Sheet


제품 이미지

IHC Application Icon
WB Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.