CacheBy
Atlas Antibodies Anti-COG6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COG6 Antibody

상품 한눈에 보기

Human COG6 단백질에 특이적인 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human, Mouse, Rat에 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040410-100 Anti-COG6 Antibody, component of oligomeric golgi complex 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040410-25 Anti-COG6 Antibody, component of oligomeric golgi complex 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COG6 Antibody

Anti-COG6 Antibody

Target: Component of Oligomeric Golgi Complex 6 (COG6)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human COG6 protein.

Alternative Gene Names

COD2, KIAA1134

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Component of Oligomeric Golgi Complex 6
Target Gene COG6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
HLEALLKHVTTQGVEENIQEVVGHITEGVCRPLKVRIEQVIVAEPGAVLLYKISNLLKFYHHTISGIVGNSATALLTTIEEMHLLSKKIFFNSLSLHASKL

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000027742 (93%)
  • Rat ENSRNOG00000013660 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.