CacheBy
Atlas Antibodies Anti-COG7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COG7 Antibody

상품 한눈에 보기

Human COG7 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 재조합 발현 검증이 완료되었습니다. 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041824-100 Anti-COG7 Antibody, component of oligomeric golgi complex 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041824-25 Anti-COG7 Antibody, component of oligomeric golgi complex 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COG7 Antibody

Anti-COG7 Antibody

Component of oligomeric Golgi complex 7

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
  • ICC (Immunocytochemistry)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against Human COG7.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Component of oligomeric Golgi complex 7
Target Gene COG7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAAFTSQAVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQ
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000034951 (96%), Rat ENSRNOG00000060008 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.