CacheBy
Atlas Antibodies Anti-COG5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COG5 Antibody

상품 한눈에 보기

Human COG5 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 ICC 실험에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. PBS/glycerol buffer에 보존되며 sodium azide를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041583-100 Anti-COG5 Antibody, component of oligomeric golgi complex 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041583-25 Anti-COG5 Antibody, component of oligomeric golgi complex 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COG5 Antibody

Anti-COG5 Antibody

Target: Component of oligomeric Golgi complex 5 (COG5)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human COG5.


Alternative Gene Names

  • GOLTC1
  • GTC90

Open Datasheet


Target Information

항목 내용
Target Protein Component of oligomeric Golgi complex 5
Target Gene COG5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000035933 (84%), Rat ENSRNOG00000056610 (84%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

SFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVD

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.