
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CLPB Antibody
상품 한눈에 보기
Human CLPB 단백질을 타깃으로 하는 Rabbit Polyclonal Antibody로, IHC 및 WB에서 독립적 항체 검증을 통해 단백질 발현 확인에 적합. Affinity purification 방식으로 높은 특이성과 재현성을 제공. Human, Rat, Mouse 반응성 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039005-100 Anti-CLPB Antibody, ClpB caseinolytic peptidase B homolog (E. coli) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039005-25 Anti-CLPB Antibody, ClpB caseinolytic peptidase B homolog (E. coli) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CLPB Antibody
Anti-CLPB Antibody
ClpB caseinolytic peptidase B homolog (E. coli)
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human CLPB.
Alternative Gene Names
FLJ13152, HSP78, SKD3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ClpB caseinolytic peptidase B homolog (E. coli) |
| Target Gene | CLPB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000019693 (100%), Mouse ENSMUSG00000001829 (99%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
GKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWANotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet (Sodium Azide)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



