CacheBy
Atlas Antibodies Anti-CLPB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-CLPB Antibody

상품 한눈에 보기

Human CLPB 단백질을 타깃으로 하는 Rabbit Polyclonal Antibody로, IHC 및 WB에서 독립적 항체 검증을 통해 단백질 발현 확인에 적합. Affinity purification 방식으로 높은 특이성과 재현성을 제공. Human, Rat, Mouse 반응성 확인됨.

브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039005-100 Anti-CLPB Antibody, ClpB caseinolytic peptidase B homolog (E. coli) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039005-25 Anti-CLPB Antibody, ClpB caseinolytic peptidase B homolog (E. coli) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CLPB Antibody

Anti-CLPB Antibody

ClpB caseinolytic peptidase B homolog (E. coli)

  • IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human CLPB.

Alternative Gene Names

FLJ13152, HSP78, SKD3

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein ClpB caseinolytic peptidase B homolog (E. coli)
Target Gene CLPB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000019693 (100%), Mouse ENSMUSG00000001829 (99%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

GKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWA

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (Sodium Azide)

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-CLPP Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-CLPSL1 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-CLPS Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-CLPB Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.