CacheBy
Atlas Antibodies Anti-PSME2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSME2 Antibody

상품 한눈에 보기

Human PSME2 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB 및 ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 대해 검증되었으며, Mouse와 Rat에서도 높은 서열 유사성을 보입니다.

카탈로그번호
HPA062661-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062661-100 Anti-PSME2 Antibody, proteasome activator subunit 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062661-25 Anti-PSME2 Antibody, proteasome activator subunit 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSME2 Antibody

Anti-PSME2 Antibody

Target: Proteasome activator subunit 2 (PSME2)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PSME2.


Alternative Gene Names

  • PA28beta

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Proteasome activator subunit 2
Target Gene PSME2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000079197 (93%)
Rat ENSRNOG00000019246 (90%)

Antigen Sequence:
IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.