CacheBy
Atlas Antibodies Anti-PSMD9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMD9 Antibody

상품 한눈에 보기

Human PSMD9 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며 높은 종간 특이성을 보유. 40% glycerol/PBS buffer로 안정적 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA044220-100 Anti-PSMD9 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044220-25 Anti-PSMD9 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMD9 Antibody

Anti-PSMD9 Antibody

Target Protein: proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
Supplier: Atlas Antibodies


  • IHC (Independent validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Validation:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human PSMD9

Alternative Gene Names

  • p27
  • Rpn4

Open Datasheet


Specifications

항목 내용
Target Protein proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
Target Gene PSMD9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SDEEARQSGGSSQAGAVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVR
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000001339 (83%), Mouse ENSMUSG00000029440 (78%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.