CacheBy
Atlas Antibodies Anti-PSME4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSME4 Antibody

상품 한눈에 보기

Human PSME4 단백질에 특이적인 rabbit polyclonal antibody로, WB, IHC, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 가짐. 안정적인 PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA060922-100 Anti-PSME4 Antibody, proteasome (prosome, macropain) activator subunit 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060922-25 Anti-PSME4 Antibody, proteasome (prosome, macropain) activator subunit 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSME4 Antibody

Anti-PSME4 Antibody

Target Information

  • Target Protein: Proteasome (prosome, macropain) activator subunit 4
  • Target Gene: PSME4
  • Alternative Gene Names: KIAA0077, PA200

Product Description

Polyclonal antibody against human PSME4.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VTQQQFKGALYCLLGNHSGVCLANLHDWDCIVQTWPAIVSSGLSQAMSLEKPSIVRLFDDLAEKIHRQYETIGLDFTIPKSCVEIAELLQQSK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000040850): 97%
  • Rat (ENSRNOG00000060340): 97%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.