Atlas Antibodies Anti-PSMD4 Antibody

상품 한눈에 보기

인간 PSMD4 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 및 재조합 발현을 통한 검증 완료. 친화 정제된 고품질 항체로 안정적인 실험 결과 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038807-100 Anti-PSMD4 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038807-25 Anti-PSMD4 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Recombinant Expression): Recombinant expression validation in WB using target protein overexpression.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against human PSMD4.

AF, AF-1, Rpn10, S5A

항목	내용
Target Protein	proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Target Gene	PSMD4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000021042 (96%), Mouse ENSMUSG00000005625 (87%)