CacheBy
Atlas Antibodies Anti-PSMD4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMD4 Antibody

상품 한눈에 보기

인간 PSMD4 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 및 재조합 발현을 통한 검증 완료. 친화 정제된 고품질 항체로 안정적인 실험 결과 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA038807-100 Anti-PSMD4 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038807-25 Anti-PSMD4 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMD4 Antibody

Anti-PSMD4 Antibody

Target: proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Recombinant Expression): Recombinant expression validation in WB using target protein overexpression.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human PSMD4.


Alternative Gene Names

AF, AF-1, Rpn10, S5A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Target Gene PSMD4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000021042 (96%), Mouse ENSMUSG00000005625 (87%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation
WB Recombinant Expression
Tooltip Recombinant Expression
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.