CacheBy
Atlas Antibodies Anti-PSMC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMC1 Antibody

상품 한눈에 보기

Human PSMC1 단백질에 대한 고특이성 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체로 PrEST 항원 기반 정제. Human, Mouse, Rat에 반응 검증 완료.

카탈로그번호
HPA000872-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000872-100 Anti-PSMC1 Antibody, proteasome (prosome, macropain) 26S subunit, ATPase, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000872-25 Anti-PSMC1 Antibody, proteasome (prosome, macropain) 26S subunit, ATPase, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMC1 Antibody

Anti-PSMC1 Antibody

Target Information

  • Target Protein: Proteasome (prosome, macropain) 26S subunit, ATPase, 1
  • Target Gene: PSMC1
  • Alternative Gene Names: p56, S4

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000003951 (100%)
  • Mouse ENSMUSG00000021178 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.