CacheBy
Atlas Antibodies Anti-PSMC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMC1 Antibody

상품 한눈에 보기

Human PSMC1 단백질에 대한 고특이성 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체로 PrEST 항원 기반 정제. Human, Mouse, Rat에 반응 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA000872-100 Anti-PSMC1 Antibody, proteasome (prosome, macropain) 26S subunit, ATPase, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000872-25 Anti-PSMC1 Antibody, proteasome (prosome, macropain) 26S subunit, ATPase, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMC1 Antibody

Anti-PSMC1 Antibody

Target Information

  • Target Protein: Proteasome (prosome, macropain) 26S subunit, ATPase, 1
  • Target Gene: PSMC1
  • Alternative Gene Names: p56, S4

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000003951 (100%)
  • Mouse ENSMUSG00000021178 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.