CacheBy
Atlas Antibodies Anti-PRUNE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRUNE1 Antibody

상품 한눈에 보기

Human PRUNE1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, 보존 용액은 PBS와 글리세롤 기반입니다.

카탈로그번호
HPA028411-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028411-100 Anti-PRUNE1 Antibody, prune exopolyphosphatase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028411-25 Anti-PRUNE1 Antibody, prune exopolyphosphatase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRUNE1 Antibody

Anti-PRUNE1 Antibody

Target Information

  • Target Protein: prune exopolyphosphatase
  • Target Gene: PRUNE1
  • Alternative Gene Names: DRES-17, H-PRUNE, HTCD37, PRUNE

Product Description

Polyclonal Antibody against Human PRUNE1.

  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000015711 76%
Rat ENSRNOG00000021120 71%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.