
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PRSS54 Antibody
상품 한눈에 보기
Human PRSS54 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 및 WB 검증에 적합합니다. Orthogonal 및 Recombinant Expression Validation을 통해 높은 신뢰성 확보. Affinity purification으로 높은 특이성과 재현성 제공.
- 카탈로그번호
- HPA041549-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041549-100 Anti-PRSS54 Antibody, protease, serine, 54 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041549-25 Anti-PRSS54 Antibody, protease, serine, 54 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PRSS54 Antibody
Anti-PRSS54 Antibody
Target: protease, serine, 54
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human PRSS54
Alternative Gene Names
CT67, FLJ25339, KLKBL4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protease, serine, 54 |
| Target Gene | PRSS54 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000048400 (68%), Rat ENSRNOG00000023092 (64%) |
Antigen Sequence:
VFYGPDPKEGLVSSMEFPWVVSLQDSQYTHLAFGCILSEFWVLSIASAIQNRKDIVVIVGISNMDPSKIAHTEYPVNTIIIHEDFDNNSMSN
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



