CacheBy
Atlas Antibodies Anti-PRSS54 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRSS54 Antibody

상품 한눈에 보기

Human PRSS54 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 및 WB 검증에 적합합니다. Orthogonal 및 Recombinant Expression Validation을 통해 높은 신뢰성 확보. Affinity purification으로 높은 특이성과 재현성 제공.

카탈로그번호
HPA041549-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041549-100 Anti-PRSS54 Antibody, protease, serine, 54 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041549-25 Anti-PRSS54 Antibody, protease, serine, 54 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS54 Antibody

Anti-PRSS54 Antibody

Target: protease, serine, 54
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human PRSS54


Alternative Gene Names

CT67, FLJ25339, KLKBL4

Open Datasheet


Target Information

항목 내용
Target Protein protease, serine, 54
Target Gene PRSS54
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000048400 (68%), Rat ENSRNOG00000023092 (64%)

Antigen Sequence:
VFYGPDPKEGLVSSMEFPWVVSLQDSQYTHLAFGCILSEFWVLSIASAIQNRKDIVVIVGISNMDPSKIAHTEYPVNTIIIHEDFDNNSMSN


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.