
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PRSS8 Antibody
상품 한눈에 보기
Human PRSS8 단백질에 대한 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종 간 서열 동일성으로 인간, 마우스, 랫트 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA030436-100 Anti-PRSS8 Antibody, protease, serine, 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030436-25 Anti-PRSS8 Antibody, protease, serine, 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PRSS8 Antibody
Anti-PRSS8 Antibody
Target: protease, serine, 8
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human PRSS8.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protease, serine, 8 |
| Target Gene | PRSS8 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000030800 (87%), Rat ENSRNOG00000019616 (87%) |
Antigen Information
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYV
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



