CacheBy
Atlas Antibodies Anti-PRSS45 Antibody
원본

Atlas Antibodies Anti-PRSS45 Antibody

상품 한눈에 보기

Human PRSS45 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 등 다양한 연구 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human 반응성이 검증되어 단백질 발현 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA060284-100 Anti-PRSS45 Antibody, protease, serine, 45 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060284-25 Anti-PRSS45 Antibody, protease, serine, 45 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS45 Antibody

Anti-PRSS45 Antibody

Target Information

  • Target Protein: protease, serine, 45
  • Target Gene: PRSS45
  • Alternative Gene Names: TESSP5

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human PRSS45

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AHCIQGTKEYSVVLGTSKLQPMNFSRALWVPVRDIIMHPKYWGRAFIMGDVALVHLQTP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000047257): 64%
  • Rat (ENSRNOG00000029649): 64%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

Material Safety Data Sheet
Open Datasheet

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.