CacheBy
Atlas Antibodies Anti-PRSS12 Antibody
원본

Atlas Antibodies Anti-PRSS12 Antibody

상품 한눈에 보기

인간 PRSS12 단백질을 표적으로 하는 폴리클로날 항체로 신경트립신(neurotrypsin) 연구에 적합함. Rabbit 호스트에서 생산된 IgG 형 항체이며, IHC 및 ICC 응용에 추천됨. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035054-100 Anti-PRSS12 Antibody, protease, serine, 12 (neurotrypsin, motopsin) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035054-25 Anti-PRSS12 Antibody, protease, serine, 12 (neurotrypsin, motopsin) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS12 Antibody

Anti-PRSS12 Antibody

Target Protein: protease, serine, 12 (neurotrypsin, motopsin)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PRSS12.

Alternative Gene Names

  • BSSP-3
  • MRT1

Open Datasheet

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    GTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000015353 (43%)
  • Mouse ENSMUSG00000027978 (42%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.