
원본
Atlas Antibodies Anti-PRSS12 Antibody
상품 한눈에 보기
인간 PRSS12 단백질을 표적으로 하는 폴리클로날 항체로 신경트립신(neurotrypsin) 연구에 적합함. Rabbit 호스트에서 생산된 IgG 형 항체이며, IHC 및 ICC 응용에 추천됨. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA035054-100 Anti-PRSS12 Antibody, protease, serine, 12 (neurotrypsin, motopsin) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035054-25 Anti-PRSS12 Antibody, protease, serine, 12 (neurotrypsin, motopsin) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PRSS12 Antibody
Anti-PRSS12 Antibody
Target Protein: protease, serine, 12 (neurotrypsin, motopsin)
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PRSS12.
Alternative Gene Names
- BSSP-3
- MRT1
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
GTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFS
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000015353 (43%)
- Mouse ENSMUSG00000027978 (42%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



