CacheBy
Atlas Antibodies Anti-PRSS22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRSS22 Antibody

상품 한눈에 보기

Human PRSS22 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 주요 종 반응성은 Human이며, Mouse 및 Rat과 80% 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA049161-100 Anti-PRSS22 Antibody, protease, serine, 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049161-25 Anti-PRSS22 Antibody, protease, serine, 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS22 Antibody

Anti-PRSS22 Antibody

Target Protein: protease, serine, 22
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PRSS22.

Alternative Gene Names

BSSP-4, hBSSP-4, SP001LA

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein protease, serine, 22
Target Gene PRSS22
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWV

Verified Species Reactivity

  • Human

Interspecies Information

종 유전자 ID 서열 유사도
Mouse ENSMUSG00000045027 80%
Rat ENSRNOG00000039698 80%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.