CacheBy
Atlas Antibodies Anti-PRSS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRSS1 Antibody

상품 한눈에 보기

Human PRSS1 단백질을 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 응용에 적합. Affinity purification 방식으로 높은 특이성과 재현성을 제공. Recombinant PrEST 항원을 사용하여 제작됨. Human에 대해 검증된 반응성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA063471-100 Anti-PRSS1 Antibody, protease, serine, 1 (trypsin 1) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063471-25 Anti-PRSS1 Antibody, protease, serine, 1 (trypsin 1) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS1 Antibody

Anti-PRSS1 Antibody

Target: protease, serine, 1 (trypsin 1)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human PRSS1 (protease, serine, 1; trypsin 1).

Alternative Gene Names

  • TRY1

Open Datasheet

Target Information

항목 내용
Target Protein protease, serine, 1 (trypsin 1)
Target Gene PRSS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000050119 (90%), Mouse ENSMUSG00000071519 (90%)

Antigen Sequence:
RIQVRLGEHNIEVLEGNEQFINAAKIIRHP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.