CacheBy
Atlas Antibodies Anti-PRSS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRSS1 Antibody

상품 한눈에 보기

Human PRSS1 단백질을 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 응용에 적합. Affinity purification 방식으로 높은 특이성과 재현성을 제공. Recombinant PrEST 항원을 사용하여 제작됨. Human에 대해 검증된 반응성.

카탈로그번호
HPA063471-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063471-100 Anti-PRSS1 Antibody, protease, serine, 1 (trypsin 1) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063471-25 Anti-PRSS1 Antibody, protease, serine, 1 (trypsin 1) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS1 Antibody

Anti-PRSS1 Antibody

Target: protease, serine, 1 (trypsin 1)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human PRSS1 (protease, serine, 1; trypsin 1).

Alternative Gene Names

  • TRY1

Open Datasheet

Target Information

항목 내용
Target Protein protease, serine, 1 (trypsin 1)
Target Gene PRSS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000050119 (90%), Mouse ENSMUSG00000071519 (90%)

Antigen Sequence:
RIQVRLGEHNIEVLEGNEQFINAAKIIRHP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.