Atlas Antibodies Anti-PRR20A Antibody

상품 한눈에 보기

인간 PRR20A 단백질을 표적으로 하는 폴리클로날 항체. 토끼에서 생산된 IgG 형식으로, IHC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용해 친화 정제됨. PBS와 글리세롤 버퍼에 보존되어 안정적 사용 가능.

카탈로그번호: HPA059485-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA059485-100 Anti-PRR20A Antibody, proline rich 20A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA059485-25 Anti-PRR20A Antibody, proline rich 20A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PRR20A Antibody

Anti-PRR20A Antibody

Target Protein: proline rich 20A
Gene Symbol: PRR20A
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human PRR20A (proline rich 20A).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended for immunohistochemistry (IHC) and related applications.

Alternative Gene Names

FLJ40296
PRR20

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000029636	36%
Rat	ENSRNOG00000026675	35%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	Immunohistochemistry (IHC)
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.