Atlas Antibodies Anti-PRR18 Antibody

상품 한눈에 보기

Human PRR18 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 단백질 발현을 확인함. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대한 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA077250-100 Anti-PRR18 Antibody, proline rich 18 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA077250-25 Anti-PRR18 Antibody, proline rich 18 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: proline rich 18 (PRR18)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human PRR18, validated for orthogonal IHC analysis.

항목	내용
Target Protein	proline rich 18
Target Gene	PRR18
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000055945 (75%), Rat ENSRNOG00000024149 (73%)

Antigen Sequence:

CPDSAARFSLNLTPEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLPAR

항목	내용
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage	Store at -20°C, avoid repeated freeze-thaw cycles