CacheBy
Atlas Antibodies Anti-PRR19 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRR19 Antibody

상품 한눈에 보기

Human PRR19 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용으로 적합함. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 신뢰성을 제공. Human에 반응하며, Rat 및 Mouse와 유사 서열 보유.

카탈로그번호
HPA070350-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070350-100 Anti-PRR19 Antibody, proline rich 19 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070350-25 Anti-PRR19 Antibody, proline rich 19 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRR19 Antibody

Anti-PRR19 Antibody

Target Information

  • Target Protein: Proline rich 19
  • Target Gene: PRR19
  • Alternative Gene Names: MGC70924

Product Description

Polyclonal antibody against Human PRR19.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended for use in immunocytochemistry and related applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DARDAIVHTLQACHGCVPDLALVLRGCQPPLPGAKPGVSERKMTPFWINSPDQVPEQER

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000043154 (62%)
  • Mouse ENSMUSG00000058741 (57%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen
Recommended Applications Immunocytochemistry (ICC)
Datasheet Open Datasheet (PDF)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.