Atlas Antibodies Anti-PRR19 Antibody

상품 한눈에 보기

Human PRR19 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용으로 적합함. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 신뢰성을 제공. Human에 반응하며, Rat 및 Mouse와 유사 서열 보유.

카탈로그번호: HPA070350-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA070350-100 Anti-PRR19 Antibody, proline rich 19 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA070350-25 Anti-PRR19 Antibody, proline rich 19 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PRR19 Antibody

Anti-PRR19 Antibody

Target Information

Target Protein: Proline rich 19
Target Gene: PRR19
Alternative Gene Names: MGC70924

Product Description

Polyclonal antibody against Human PRR19.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended for use in immunocytochemistry and related applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DARDAIVHTLQACHGCVPDLALVLRGCQPPLPGAKPGVSERKMTPFWINSPDQVPEQER

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000043154 (62%)
Mouse ENSMUSG00000058741 (57%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	Immunocytochemistry (ICC)
Datasheet	Open Datasheet (PDF)
MSDS	Material Safety Data Sheet