Atlas Antibodies Anti-PRPF40B Antibody

상품 한눈에 보기

Human PRPF40B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 RNA-seq 데이터 기반 Orthogonal 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 제공하며, Human에 반응함. 연구용으로 최적화된 항체.

카탈로그번호: HPA038599-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038599-100 Anti-PRPF40B Antibody, PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038599-25 Anti-PRPF40B Antibody, PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PRPF40B Antibody

Anti-PRPF40B Antibody

PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae)

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human PRPF40B

Alternative Gene Names

HYPC

Open Datasheet

Target Information

항목	내용
Target Protein	PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae)
Target Gene	PRPF40B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	KSNSPESETDPEEKAGKESDEKEQEQDKDRELQQAELPNRSPGFGIKKEKTGWDTSESE
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000023007 (83%), Rat ENSRNOG00000052539 (83%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand