CacheBy
Atlas Antibodies Anti-PRKAR1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRKAR1A Antibody

상품 한눈에 보기

Human PRKAR1A 단백질에 특이적인 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 다양한 종 간 교차 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA049979-100 Anti-PRKAR1A Antibody, protein kinase, cAMP-dependent, regulatory, type I, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049979-25 Anti-PRKAR1A Antibody, protein kinase, cAMP-dependent, regulatory, type I, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRKAR1A Antibody

Anti-PRKAR1A Antibody

Target: protein kinase, cAMP-dependent, regulatory, type I, alpha
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human PRKAR1A.


Alternative Gene Names

CNC1, PRKAR1, TSE1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein protein kinase, cAMP-dependent, regulatory, type I, alpha
Target Gene PRKAR1A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000049876 (90%)
Mouse ENSMUSG00000020612 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative.
Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.