Atlas Antibodies Anti-PRKAG1 Antibody

상품 한눈에 보기

Human PRKAG1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성 제공. ICC 등 다양한 응용에 적합하며 Human 종에 반응 확인됨. 안정적 PBS/glycerol buffer에 보존.

카탈로그번호: HPA077805-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA077805-100 Anti-PRKAG1 Antibody, protein kinase, AMP-activated, gamma 1 non-catalytic subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA077805-25 Anti-PRKAG1 Antibody, protein kinase, AMP-activated, gamma 1 non-catalytic subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PRKAG1 Antibody

Anti-PRKAG1 Antibody

Target: protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Supplier: Atlas Antibodies

Recommended Applications

ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human PRKAG1.

Open Datasheet

Target Information

Target Protein: protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Target Gene: PRKAG1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence: METVISSDSSPAVENEHPQETPESNNSVYT

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000067713): 67%
Rat (ENSRNOG00000061499): 60%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS	Material Safety Data Sheet