CacheBy
Atlas Antibodies Anti-PRKAG2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRKAG2 Antibody

상품 한눈에 보기

인간 PRKAG2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼에서 유래한 IgG 항체이며, 친화정제 방식으로 고순도 확보. 인간, 마우스, 랫트에 반응성이 검증되었습니다.

카탈로그번호
HPA004246-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004246-100 Anti-PRKAG2 Antibody, protein kinase, AMP-activated, gamma 2 non-catalytic subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004246-25 Anti-PRKAG2 Antibody, protein kinase, AMP-activated, gamma 2 non-catalytic subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRKAG2 Antibody

Anti-PRKAG2 Antibody

Target: protein kinase, AMP-activated, gamma 2 non-catalytic subunit
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PRKAG2.


Alternative Gene Names

AAKG, AAKG2, CMH6, H91620p, WPWS

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein protein kinase, AMP-activated, gamma 2 non-catalytic subunit
Target Gene PRKAG2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence STPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHK

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000009085 (84%)
  • Mouse ENSMUSG00000028944 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.