CacheBy
Atlas Antibodies Anti-PPP1R3C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP1R3C Antibody

상품 한눈에 보기

Human PPP1R3C 단백질에 대한 고품질 폴리클로날 항체. IHC 및 WB에 적합. Rabbit 호스트에서 생산된 IgG 형 항체로, PrEST 항원으로 친화 정제됨. 인간, 마우스, 랫트 간 교차 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA027041-100 Anti-PPP1R3C Antibody, protein phosphatase 1, regulatory subunit 3C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027041-25 Anti-PPP1R3C Antibody, protein phosphatase 1, regulatory subunit 3C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP1R3C Antibody

Anti-PPP1R3C Antibody

Target: protein phosphatase 1, regulatory subunit 3C
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human PPP1R3C.


Alternative Gene Names

  • PPP1R5
  • PTG

Open Datasheet


Target Information

항목 내용
Target Protein protein phosphatase 1, regulatory subunit 3C
Target Gene PPP1R3C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (86%), Rat (84%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

PRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDL


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.