
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP1R13L Antibody
상품 한눈에 보기
Human PPP1R13L 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. siRNA 노크다운으로 유전적 검증 완료. IASPP, RAI 등 대체 유전자명으로도 알려짐. 친화 정제된 고순도 항체.
- 카탈로그번호
- HPA059883-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059883-100 Anti-PPP1R13L Antibody, protein phosphatase 1, regulatory subunit 13 like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059883-25 Anti-PPP1R13L Antibody, protein phosphatase 1, regulatory subunit 13 like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP1R13L Antibody
Anti-PPP1R13L Antibody
protein phosphatase 1, regulatory subunit 13 like
Atlas Antibodies에서 제공하는 Human PPP1R13L 단백질에 대한 폴리클로날 항체입니다.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
- Genetic validation in WB by siRNA knockdown
Product Description
Polyclonal Antibody against Human PPP1R13L
Alternative Gene Names
IASPP, RAI
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 1, regulatory subunit 13 like |
| Target Gene | PPP1R13L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse: 84% (ENSMUSG00000040734), Rat: 82% (ENSRNOG00000025350) |
Antigen Sequence
DSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQAGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSP
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



