CacheBy
Atlas Antibodies Anti-CLIC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLIC4 Antibody

상품 한눈에 보기

Human CLIC4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 Orthogonal Validation 완료. 고순도 Affinity 정제 제품이며, 40% 글리세롤 및 PBS 완충액에 보존. 다양한 조직 및 세포주에서 CLIC4 발현 연구에 적합.

카탈로그번호
HPA008019-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008019-100 Anti-CLIC4 Antibody, chloride intracellular channel 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008019-25 Anti-CLIC4 Antibody, chloride intracellular channel 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLIC4 Antibody

Anti-CLIC4 Antibody

Target: Chloride intracellular channel 4 (CLIC4)
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • WB (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression cell lines.

Product Description

Polyclonal antibody against human CLIC4.


Alternative Gene Names

CLIC4L, DKFZP566G223, H1, huH1, P64H1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chloride intracellular channel 4
Target Gene CLIC4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGI
Verified Species Reactivity Human
Interspecies Identity Mouse (98%), Rat (97%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.