CacheBy
Atlas Antibodies Anti-CLCN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLCN2 Antibody

상품 한눈에 보기

인간 CLCN2 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. 토끼에서 생산된 IgG 형태로, PrEST 항원을 이용해 친화 정제됨. 인간, 쥐, 랫트에 높은 교차 반응성 보임. 40% 글리세롤 및 PBS 완충액에 보존제 포함.

카탈로그번호
HPA014545-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014545-100 Anti-CLCN2 Antibody, chloride channel, voltage-sensitive 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014545-25 Anti-CLCN2 Antibody, chloride channel, voltage-sensitive 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLCN2 Antibody

Anti-CLCN2 Antibody

Target: Chloride channel, voltage-sensitive 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CLCN2.

Alternative Gene Names: ClC-2, CLC2, EJM6
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chloride channel, voltage-sensitive 2
Target Gene CLCN2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000050854 (99%)
  • Mouse ENSMUSG00000022843 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.