CacheBy
Atlas Antibodies Anti-CLCN3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLCN3 Antibody

상품 한눈에 보기

Human CLCN3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. ClC-3/CLC3로도 알려진 chloride channel, voltage-sensitive 3 단백질 검출에 사용됩니다. 고순도 Affinity 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044723-100 Anti-CLCN3 Antibody, chloride channel, voltage-sensitive 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044723-25 Anti-CLCN3 Antibody, chloride channel, voltage-sensitive 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLCN3 Antibody

Anti-CLCN3 Antibody

Target: chloride channel, voltage-sensitive 3 (CLCN3)
Type: Polyclonal Antibody against Human CLCN3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

This polyclonal antibody targets the human CLCN3 gene, also known as ClC-3 or CLC3, which encodes a voltage-sensitive chloride channel protein.

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

NSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEP

Species Reactivity

  • Verified: Human, Mouse, Rat

Interspecies Homology:
| Species | Gene ID | Sequence Identity |
|----------|----------|-------------------|
| Rat | ENSRNOG00000010682 | 97% |
| Mouse | ENSMUSG00000004319 | 97% |


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.