Atlas Antibodies Anti-CLDN10 Antibody

상품 한눈에 보기

인체 CLDN10 단백질을 타깃으로 한 폴리클로날 항체. IHC를 통한 단백질 발현 검증에 적합. 토끼 유래 IgG 형태로 높은 특이성과 재현성 제공. PrEST 항원으로 친화 정제된 고품질 연구용 시약.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042348-100 Anti-CLDN10 Antibody, claudin 10 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042348-25 Anti-CLDN10 Antibody, claudin 10 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Claudin 10
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human CLDN10

항목	내용
Target Protein	Claudin 10
Target Gene	CLDN10
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	ISDNNKTPRYTYNGATSVMSSRTKYHGGEDF
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000010085 (82%) Mouse ENSMUSG00000022132 (79%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand