CacheBy
Atlas Antibodies Anti-CHMP4C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHMP4C Antibody

상품 한눈에 보기

Human CHMP4C 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 및 Orthogonal 검증에 적합. PrEST 항원을 이용해 친화 정제됨. RNA-seq 데이터 기반 단백질 발현 비교 검증 지원. Human에 대한 특이성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023799-100 Anti-CHMP4C Antibody, charged multivesicular body protein 4C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023799-25 Anti-CHMP4C Antibody, charged multivesicular body protein 4C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHMP4C Antibody

Anti-CHMP4C Antibody

Target: charged multivesicular body protein 4C
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human CHMP4C.


Alternative Gene Names

MGC22825, Shax3, VPS32C

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein charged multivesicular body protein 4C
Target Gene CHMP4C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000027536 (85%), Rat ENSRNOG00000010238 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.