CacheBy
Atlas Antibodies Anti-CFAP70 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CFAP70 Antibody

상품 한눈에 보기

Human CFAP70 단백질을 인식하는 토끼 폴리클로날 항체로, 섬모 및 편모 관련 단백질 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070304-100 Anti-CFAP70 Antibody, cilia and flagella associated protein 70 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070304-25 Anti-CFAP70 Antibody, cilia and flagella associated protein 70 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CFAP70 Antibody

Anti-CFAP70 Antibody

Target: cilia and flagella associated protein 70 (CFAP70)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human CFAP70 protein.

Alternative Gene Names

  • FLJ25765
  • TTC18

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein cilia and flagella associated protein 70
Target Gene CFAP70
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000039543 (81%), Rat ENSRNOG00000007046 (76%)

Antigen Sequence:
AVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQ

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.