Atlas Antibodies Anti-CFAP69 Antibody

상품 한눈에 보기

Human CFAP69 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합. Rabbit 호스트에서 제작되었으며, PrEST 항원을 이용해 친화 정제됨. Human에 대한 반응성이 검증된 고품질 연구용 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062883-100 Anti-CFAP69 Antibody, cilia and flagella associated protein 69 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062883-25 Anti-CFAP69 Antibody, cilia and flagella associated protein 69 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal Antibody against Human CFAP69

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQA

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	Immunohistochemistry (IHC)
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.