CacheBy
Atlas Antibodies Anti-CFAP58 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CFAP58 Antibody

상품 한눈에 보기

인간 CFAP58 단백질을 인식하는 폴리클로날 항체. 섬모 및 편모 관련 단백질 연구에 적합. 토끼 유래 IgG로 PrEST 항원을 이용해 친화정제됨. IHC 등 다양한 응용에 사용 가능.

카탈로그번호
HPA036556-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036556-100 Anti-CFAP58 Antibody, cilia and flagella associated protein 58 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036556-25 Anti-CFAP58 Antibody, cilia and flagella associated protein 58 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CFAP58 Antibody

Anti-CFAP58 Antibody

Target: cilia and flagella associated protein 58 (CFAP58)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human CFAP58 protein.


Alternative Gene Names

bA554P13.1, C10orf80, CCDC147, FLJ35908

Open Datasheet


Target Information

항목 내용
Target Protein cilia and flagella associated protein 58
Target Gene CFAP58
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKE

Species Reactivity

항목 내용
Verified Species Reactivity Human
Ortholog Identity Rat ENSRNOG00000053565 (84%)
Mouse ENSMUSG00000046585 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.