CacheBy
Atlas Antibodies Anti-CENPN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CENPN Antibody

상품 한눈에 보기

인간 CENPN 단백질을 인식하는 토끼 폴리클로날 항체입니다. Affinity purification으로 높은 특이성과 재현성을 보장합니다. 세포면역염색(ICC) 등 다양한 응용에 적합합니다. 글리세롤 기반 완충용액에 보존되어 장기 보관이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052870-100 Anti-CENPN Antibody, centromere protein N 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052870-25 Anti-CENPN Antibody, centromere protein N 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CENPN Antibody

Anti-CENPN Antibody

Centromere protein N

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human centromere protein N (CENPN).

Alternative Gene Names

BM039, C16orf60, FLJ13607, FLJ22660

Open Datasheet

Target Information

항목 내용
Target Protein Centromere protein N
Target Gene CENPN
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000011296 (63%), Mouse ENSMUSG00000031756 (63%)

Antigen Sequence:

DETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWEV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.