Atlas Antibodies Anti-CDCA8 Antibody

상품 한눈에 보기

인간 CDCA8 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 이용해 친화 정제됨. RNA-seq 및 재조합 발현 기반의 강화 검증 완료. 휴먼 특이성 확인됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028258-100 Anti-CDCA8 Antibody, cell division cycle associated 8 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028258-25 Anti-CDCA8 Antibody, cell division cycle associated 8 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cell division cycle associated 8 (CDCA8)
Clonality: Polyclonal
Host: Rabbit
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant Expression): Recombinant expression validation in WB using target protein overexpression.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against human CDCA8, validated for multiple applications with enhanced validation standards.

BOR, DasraB, FLJ12042, MESRGP

항목	내용
Target Protein	cell division cycle associated 8
Target Gene	CDCA8
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000031431 (66%), Mouse ENSMUSG00000028873 (64%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS	Material Safety Data Sheet