Atlas Antibodies Anti-CD5L Antibody

상품 한눈에 보기

인체 CD5L 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 오쏘고날 검증 수행. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제. Human 반응성 확인, 안정적인 PBS/glycerol 버퍼 포맷 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA068384-100 Anti-CD5L Antibody, CD5 molecule-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA068384-25 Anti-CD5L Antibody, CD5 molecule-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: CD5 molecule-like
Type: Polyclonal Antibody against Human CD5L
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human CD5L.

API6, Spalpha

항목	내용
Target Protein	CD5 molecule-like
Target Gene	CD5L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000023068 (79%), Mouse ENSMUSG00000015854 (72%)

Antigen Sequence:
SCSGREATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKE

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand