CacheBy
Atlas Antibodies Anti-CD55 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CD55 Antibody

상품 한눈에 보기

Human CD55 단백질을 인식하는 고품질 Rabbit Polyclonal 항체로, IHC 및 RNA-seq 비교를 통한 Orthogonal Validation 수행. PrEST 기반 Affinity Purification으로 높은 특이성과 재현성 제공. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024386-100 Anti-CD55 Antibody, CD55 molecule, decay accelerating factor for complement (Cromer blood group) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024386-25 Anti-CD55 Antibody, CD55 molecule, decay accelerating factor for complement (Cromer blood group) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CD55 Antibody

Anti-CD55 Antibody

CD55 molecule, decay accelerating factor for complement (Cromer blood group)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CD55

Alternative Gene Names

CR, CROM, DAF, TC

Open Datasheet

Target Information

항목 내용
Target Protein CD55 molecule, decay accelerating factor for complement (Cromer blood group)
Target Gene CD55
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026399 (42%), Rat ENSRNOG00000003927 (38%)

Antigen Sequence

YCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.