CacheBy
Atlas Antibodies Anti-CD5L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CD5L Antibody

상품 한눈에 보기

사람 CD5L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 정교한 단백질 발현 검증에 적합. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 기반 완충액에 보존. 인간 시료 분석에 최적화된 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065686-100 Anti-CD5L Antibody, CD5 molecule-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065686-25 Anti-CD5L Antibody, CD5 molecule-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CD5L Antibody

Anti-CD5L Antibody

CD5 molecule-like

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human CD5L.

Alternative Gene Names

API6, Spalpha

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein CD5 molecule-like
Target Gene CD5L
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence SCSGREATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKE

Verified Species Reactivity

Human

Interspecies Information

Ortholog ID 항원 서열 일치도
Rat ENSRNOG00000023068 79%
Mouse ENSMUSG00000015854 72%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.