Atlas Antibodies Anti-CCNA2 Antibody

상품 한눈에 보기

인간 CCNA2(cyclin A2) 단백질을 인식하는 Rabbit Polyclonal 항체. WB 및 ICC에 적합하며 RNA-seq 비교를 통한 Orthogonal Validation 완료. PrEST 항원을 이용해 친화 정제되었으며, Human에 반응. 40% glycerol/PBS buffer에 보존제 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA020626-100 Anti-CCNA2 Antibody, cyclin A2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA020626-25 Anti-CCNA2 Antibody, cyclin A2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CCNA2 Antibody

Anti-CCNA2 Antibody

Target Protein: cyclin A2
Supplier: Atlas Antibodies

Recommended Applications

WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human CCNA2

Alternative Gene Names

CCN1, CCNA

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	cyclin A2
Target Gene	CCNA2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPL
Verified Species Reactivity	Human
Interspecies Information	Mouse (75%), Rat (75%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand