Atlas Antibodies Anti-CBR3 Antibody

상품 한눈에 보기

인간 CBR3 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간, 생쥐, 랫트에 반응성을 검증하였습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA018434-100 Anti-CBR3 Antibody, carbonyl reductase 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA018434-25 Anti-CBR3 Antibody, carbonyl reductase 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Carbonyl reductase 3
Supplier: Atlas Antibodies

Polyclonal antibody against human CBR3.

항목	내용
Target Protein	Carbonyl reductase 3
Target Gene	CBR3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000001701 (83%), Mouse ENSMUSG00000022947 (82%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
Safety Information	Material Safety Data Sheet