CacheBy
Atlas Antibodies Anti-CBR4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CBR4 Antibody

상품 한눈에 보기

인간 CBR4 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 사용 가능. 재조합 단백질 발현 검증 완료. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인간에 특이적 반응성을 가지며 높은 종간 보존성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037499-100 Anti-CBR4 Antibody, carbonyl reductase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037499-25 Anti-CBR4 Antibody, carbonyl reductase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CBR4 Antibody

Anti-CBR4 Antibody

Target: Carbonyl reductase 4 (CBR4)
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human CBR4.

Alternative Gene Names

  • FLJ14431
  • SDR45C1

Open Datasheet

Target Information

항목 내용
Target Protein Carbonyl reductase 4
Target Gene CBR4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSAS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031641 (89%), Rat ENSRNOG00000024411 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.