CacheBy
Atlas Antibodies Anti-CBS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CBS Antibody

상품 한눈에 보기

인간 CBS 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. 토끼 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 동일성(쥐, 생쥐 92%)을 보입니다. 40% 글리세롤 및 PBS 버퍼에 보존제로 나트륨 아지드가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001223-100 Anti-CBS Antibody, cystathionine-beta-synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001223-25 Anti-CBS Antibody, cystathionine-beta-synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CBS Antibody

Anti-CBS Antibody

Target Information

  • Target Protein: cystathionine-beta-synthase
  • Target Gene: CBS
  • Alternative Gene Name: HIP4
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CBS.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000029528): 92%
  • Mouse (ENSMUSG00000024039): 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.