CacheBy
Atlas Antibodies Anti-CBLN3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CBLN3 Antibody

상품 한눈에 보기

Human CBLN3 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성(인간, 생쥐, 랫드)을 보입니다. 안정적인 PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041266-100 Anti-CBLN3 Antibody, cerebellin 3 precursor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041266-25 Anti-CBLN3 Antibody, cerebellin 3 precursor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CBLN3 Antibody

Anti-CBLN3 Antibody

Target: cerebellin 3 precursor
Product Type: Polyclonal Antibody against Human CBLN3

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against the Human CBLN3 protein.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein cerebellin 3 precursor
Target Gene CBLN3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQV
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000040380 (97%)
Rat ENSRNOG00000020503 (96%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.