
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CASP8 Antibody
상품 한눈에 보기
Human CASP8 단백질에 특이적인 토끼 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. Apoptosis 관련 효소 Caspase-8 검출에 사용되며, PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증되었으며, 최적 조건은 사용자가 설정해야 합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA005688-100 Anti-CASP8 Antibody, caspase 8, apoptosis-related cysteine peptidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005688-25 Anti-CASP8 Antibody, caspase 8, apoptosis-related cysteine peptidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CASP8 Antibody
Anti-CASP8 Antibody
Target: caspase 8, apoptosis-related cysteine peptidase
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human CASP8, a key apoptosis-related cysteine peptidase.
Alternative Gene Names
Casp-8, FLICE, MACH, MCH5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | caspase 8, apoptosis-related cysteine peptidase |
| Target Gene | CASP8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012331 (76%), Mouse ENSMUSG00000026029 (75%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



