CacheBy
Atlas Antibodies Anti-CASP8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CASP8 Antibody

상품 한눈에 보기

인간 CASP8 단백질을 표적으로 하는 폴리클로날 항체로, apoptosis 관련 연구에 적합합니다. IHC, WB, ICC 등 다양한 응용에 사용 가능하며, 토끼에서 생산된 IgG 형 항체입니다. 고순도 친화 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001302-100 Anti-CASP8 Antibody, caspase 8, apoptosis-related cysteine peptidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001302-25 Anti-CASP8 Antibody, caspase 8, apoptosis-related cysteine peptidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CASP8 Antibody

Anti-CASP8 Antibody

Target: caspase 8, apoptosis-related cysteine peptidase
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CASP8.


Alternative Gene Names

Casp-8, FLICE, MACH, MCH5

Open Datasheet


Target Information

항목 내용
Target Protein caspase 8, apoptosis-related cysteine peptidase
Target Gene CASP8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000012331 (76%), Mouse ENSMUSG00000026029 (75%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQP

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.